GH Boosters

Sermorelin

5mg · Lyophilized Powder · Research Grade

★★★★★ Trusted by research customers
$55.00
• In Stock — Ships within 24h
Third-Party Tested
Cold Chain Shipped
Globally Sourced
COA Included
Lab Verified
Tested by Chromate Labs
Purity 98.9% (LCMS)
Batch OR-SERM-2026-0502
Tested 04/30/26
Verify Independently →
To verify this report independently at chromatelabs.org/verify, use:
Job Number Available on COA
Access Code Available on COA
Specifications
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Weight 3357.93 g/mol
Purity 98.9% (LCMS)
Form White Lyophilized Powder
Storage -20°C, protect from light
Solubility Bacteriostatic water, PBS
Origin Synthetic — Established Synthetic Partner
Batch OR-SERM-2026-0502
For Research Purposes Only. This product is intended exclusively for in-vitro research and laboratory use. Not for human consumption, medical, veterinary, or household application.

Sermorelin

Red Alpha Labs Sermorelin is supplied as a lyophilized research peptide for laboratory and in-vitro research use only.

Sermorelin is commonly studied in research settings for growth hormone pathway models, endocrine signaling research, peptide activity studies, and recovery-related laboratory models.

This product is intended strictly for qualified research purposes only. It is not intended for human consumption, medical, veterinary, cosmetic, or household use.

Product Details:
• 5mg lyophilized powder
• Research-grade peptide compound
• For laboratory research use only
• Batch and COA information can be added once available
• Not for human consumption

Product Highlights

  • High purity verified by independent HPLC analysis
  • Batch-specific Certificate of Analysis included
  • Lyophilized for maximum stability during storage and transport
  • Third-party tested for purity with batch-specific certificates of analysis
  • Cold chain shipping to maintain product integrity
Published research context Published research references for this peptide are available upon request.
Contact us via Telegram for relevant literature and citations.
Our team can provide curated research summaries and published study references for any peptide in our catalog.
Research Support

Shipping & Storage Guidelines

All Red Alpha Labs products are shipped via temperature-conscious logistics where applicable. Contact us for shipping estimates and tracking.

Shipping

  • EU Standard: 2–4 business days
  • EU Express: 1–2 business days
  • UK: 3–5 business days
  • Insulated packaging with cold packs where applicable
  • Full tracking provided upon dispatch
  • Discreet packaging — no product names on label

Storage

  • Lyophilized: -20°C long-term, 2–8°C short-term
  • Reconstituted: refrigerate according to research protocol
  • Protect from light, moisture, repeated freeze-thaw
  • Use appropriate laboratory reconstitution protocols

For Research Purposes Only. Products sold by Red Alpha Labs are strictly intended for in-vitro research and laboratory use. Not for human consumption.

Reviewed by Red Alpha Research Team

Research Overview

Sermorelin is a synthetic peptide corresponding to the first 29 amino acids of human growth hormone releasing hormone (GHRH), the shortest fragment that retains full intrinsic activity at the GHRH receptor. The sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL is supplied as a lyophilized white powder, 5mg per vial, with documented purity by HPLC and LCMS verification.
Among GHRH analogs, Sermorelin is the foundational compound studied in endocrine research because it preserves the native receptor pharmacology without the protective amino-acid substitutions found in modified analogs such as Tesamorelin or CJC-1295. This makes Sermorelin a reference standard in comparative GHRH research, half-life and DPP-IV cleavage studies, and somatotroph response testing.
Its short plasma half-life of approximately 10–12 minutes in published pharmacokinetic work has been investigated in protocols designed to elicit a clean, time-defined GH pulse rather than sustained receptor occupancy. Certificate of Analysis (CoA), HPLC purity documentation and mass spectrometry verification are available upon request.

Mechanism Studied in Research

Sermorelin has been investigated as a high-affinity agonist at the pituitary GHRH receptor (GHRH-R), a class B G-protein coupled receptor expressed on anterior pituitary somatotrophs. Binding activates adenylate cyclase, increases intracellular cAMP and triggers calcium-dependent signalling associated with GH secretion.
Published investigations have examined receptor coupling, downstream signalling pathways and GH pulse generation. Because of its native amino-acid sequence and rapid enzymatic degradation, Sermorelin has frequently been used as a benchmark compound when comparing modified GHRH analogs and long-acting growth hormone secretagogues.
Researchers continue to use Sermorelin to study hypothalamic-pituitary regulation, endocrine feedback loops and physiological growth hormone release patterns under controlled laboratory conditions.

Research Applications

Sermorelin has been investigated across multiple research domains as a reference GHRH agonist with well-characterized pharmacology.
In endocrine physiology studies, the peptide is commonly used to examine growth hormone release, pituitary responsiveness and somatotropic axis regulation. Because it acts directly at the GHRH receptor rather than ghrelin receptors, researchers frequently use it to isolate GHRH-mediated biological effects.
Additional applications include comparative pharmacology, receptor signalling research and investigations involving peptide combinations. Researchers often employ Sermorelin as a control compound when evaluating modified GHRH analogs and extended-duration secretagogues.

Reconstitution Reference

Sermorelin is supplied as a lyophilized white powder, 5mg per vial. Reconstitution is commonly performed with bacteriostatic water under sterile laboratory conditions.
A frequently used protocol introduces approximately 2.5mL of bacteriostatic water into the vial, yielding a concentration suitable for common laboratory applications. The diluent should be added slowly along the inside wall of the vial to minimize peptide disruption and excessive foaming.
Reconstituted solutions are typically stored under refrigeration and protected from repeated freeze-thaw cycles. Reconstitution details, diluent volume and final concentration are commonly documented within laboratory records.

Storage and Handling

Lyophilized Sermorelin should be stored sealed at -20°C and protected from light and moisture. Under these conditions, long-term stability is maintained according to batch-specific documentation.
Following reconstitution, working solutions are generally refrigerated at 2–8°C and used within established laboratory timelines. Repeated freeze-thaw cycles should be avoided because they may contribute to peptide degradation and reduced experimental consistency.
Researchers commonly document storage conditions, preparation dates and handling procedures to maintain chain-of-custody records and research traceability.

References

[1] Mayo K.E. et al. (1996). Growth hormone-releasing hormone receptor structure and function. Endocrine Reviews. PMID 8849264
[2] Gaylinn B.D. et al. (1998). Molecular and functional characterization of the human growth hormone releasing hormone receptor. Endocrinology. PMID 9614124
[3] Bowers C.Y. et al. (1999). Growth hormone secretagogues and pituitary regulation. Endocrine. PMID 10406416
[4] Alba M. et al. (2001). Sermorelin and growth hormone stimulation studies. Clinical Endocrinology. PMID 11436124
[5] Vance M.L. et al. (2002). Evaluation of growth hormone releasing hormone analogs in endocrine research. Journal of Clinical Endocrinology & Metabolism. PMID 12050296

Frequently Asked Questions

Sermorelin contains the native GHRH(1-29) sequence and lacks the protective modifications used in Tesamorelin and CJC-1295. Researchers often use it as a reference standard when comparing GHRH analogs.
Each batch is verified using independent analytical methods and supplied with documented purity specifications.
No. This material is supplied strictly for laboratory and in-vitro research purposes only.
Researchers commonly use bacteriostatic water when reconstituting lyophilized Sermorelin preparations.
Published research frequently compares or evaluates Sermorelin alongside growth hormone secretagogues that act through different receptor systems.
Reconstituted solutions are generally refrigerated and used within established laboratory timelines while avoiding repeated freeze-thaw cycles.
Shipping configurations depend on destination and environmental requirements. Temperature-conscious packaging may be used when appropriate.