Research Overview
Sermorelin is a synthetic peptide corresponding to the first 29 amino acids of human growth hormone releasing hormone (GHRH), the shortest fragment that retains full intrinsic activity at the GHRH receptor. The sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL is supplied as a lyophilized white powder, 5mg per vial, with documented purity by HPLC and LCMS verification.
Among GHRH analogs, Sermorelin is the foundational compound studied in endocrine research because it preserves the native receptor pharmacology without the protective amino-acid substitutions found in modified analogs such as Tesamorelin or CJC-1295. This makes Sermorelin a reference standard in comparative GHRH research, half-life and DPP-IV cleavage studies, and somatotroph response testing.
Its short plasma half-life of approximately 10–12 minutes in published pharmacokinetic work has been investigated in protocols designed to elicit a clean, time-defined GH pulse rather than sustained receptor occupancy. Certificate of Analysis (CoA), HPLC purity documentation and mass spectrometry verification are available upon request.
Mechanism Studied in Research
Sermorelin has been investigated as a high-affinity agonist at the pituitary GHRH receptor (GHRH-R), a class B G-protein coupled receptor expressed on anterior pituitary somatotrophs. Binding activates adenylate cyclase, increases intracellular cAMP and triggers calcium-dependent signalling associated with GH secretion.
Published investigations have examined receptor coupling, downstream signalling pathways and GH pulse generation. Because of its native amino-acid sequence and rapid enzymatic degradation, Sermorelin has frequently been used as a benchmark compound when comparing modified GHRH analogs and long-acting growth hormone secretagogues.
Researchers continue to use Sermorelin to study hypothalamic-pituitary regulation, endocrine feedback loops and physiological growth hormone release patterns under controlled laboratory conditions.
Research Applications
Sermorelin has been investigated across multiple research domains as a reference GHRH agonist with well-characterized pharmacology.
In endocrine physiology studies, the peptide is commonly used to examine growth hormone release, pituitary responsiveness and somatotropic axis regulation. Because it acts directly at the GHRH receptor rather than ghrelin receptors, researchers frequently use it to isolate GHRH-mediated biological effects.
Additional applications include comparative pharmacology, receptor signalling research and investigations involving peptide combinations. Researchers often employ Sermorelin as a control compound when evaluating modified GHRH analogs and extended-duration secretagogues.
Reconstitution Reference
Sermorelin is supplied as a lyophilized white powder, 5mg per vial. Reconstitution is commonly performed with bacteriostatic water under sterile laboratory conditions.
A frequently used protocol introduces approximately 2.5mL of bacteriostatic water into the vial, yielding a concentration suitable for common laboratory applications. The diluent should be added slowly along the inside wall of the vial to minimize peptide disruption and excessive foaming.
Reconstituted solutions are typically stored under refrigeration and protected from repeated freeze-thaw cycles. Reconstitution details, diluent volume and final concentration are commonly documented within laboratory records.
Storage and Handling
Lyophilized Sermorelin should be stored sealed at -20°C and protected from light and moisture. Under these conditions, long-term stability is maintained according to batch-specific documentation.
Following reconstitution, working solutions are generally refrigerated at 2–8°C and used within established laboratory timelines. Repeated freeze-thaw cycles should be avoided because they may contribute to peptide degradation and reduced experimental consistency.
Researchers commonly document storage conditions, preparation dates and handling procedures to maintain chain-of-custody records and research traceability.
References
[2] Gaylinn B.D. et al. (1998). Molecular and functional characterization of the human growth hormone releasing hormone receptor. Endocrinology. PMID 9614124
[3] Bowers C.Y. et al. (1999). Growth hormone secretagogues and pituitary regulation. Endocrine. PMID 10406416
[4] Alba M. et al. (2001). Sermorelin and growth hormone stimulation studies. Clinical Endocrinology. PMID 11436124
[5] Vance M.L. et al. (2002). Evaluation of growth hormone releasing hormone analogs in endocrine research. Journal of Clinical Endocrinology & Metabolism. PMID 12050296